LL-37 — Human Cathelicidin-Derived Antimicrobial Research Compound

Original price was: $25.00.Current price is: $17.50.

LL-37 is a cationic antimicrobial peptide (AMP) derived from the human cathelicidin hCAP-18. It is studied in laboratory settings for its role in innate immune signaling, antimicrobial peptide activity, and tissue defense mechanisms. Supplied for authorized laboratory research only. LL-37 is offered for authorized laboratory research only.

LL-37 — Human Cathelicidin-Derived Antimicrobial Peptide Research Compound

Catalog ID: LL37 | CAS: 110462-89-2 | Sequence: [LL-37, 37 aa]


Compound Overview

LL-37 is a cationic amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18.
It is studied in laboratory research for its roles in **host defense, membrane interaction dynamics, and innate immune system signaling**.
LL-37 serves as a key model compound for studying **antimicrobial mechanisms and peptide-membrane interactions**.
For laboratory research use only — not for human consumption or therapeutic application.

Molecular Characteristics

  • Synonyms: Human cathelicidin peptide; hCAP-18-derived peptide
  • CAS Number: 110462-89-2
  • Sequence: [LL-37, 37 aa]
  • Molecular Formula: C215H372N64O42
  • Molecular Weight: ≈ 4493.3 g/mol
  • Purity: ≥ 98% (HPLC verified)
  • Formulation: Lyophilized peptide powder

Physical Properties

  • Appearance: White to off-white lyophilized powder
  • Solubility: Sterile water, DMSO, or dilute acetic acid (for research use only)
  • Container: Sterile sealed vial

Storage & Stability

  • Unreconstituted: Store at −20 °C, protected from light and moisture.
  • Reconstituted: Aliquot and store at −20 °C; avoid repeated freeze–thaw cycles.

Research Context

LL-37 is widely utilized in in vitro and in vivo studies examining innate immune defense, microbial membrane disruption, and cytokine signaling pathways.
Research emphasizes its ability to interact with bacterial membranes, modulate immune cell activity, and participate in **epithelial barrier and wound-healing models**.
It serves as a critical reference molecule in studies on **antimicrobial peptide evolution, peptide-membrane energetics, and host defense regulation**.

Compliance Notice:
For laboratory research use only. Not for human use, ingestion, or therapeutic/diagnostic purposes.
Buyer assumes all responsibility for safe handling and adherence to institutional and regulatory research standards.
© Bio Health Peptides & Proteins — Research Division
Strength

5mg

Pack Size

1 vial, 3 Pack, 1/2 Kit, Full Kit

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.